TAMAN WISATA MATAHARI WATERPARK PUNCAK BOGOR BASKORO MANAGEMENT #4,805,461 (
-23%)
Selamat datang di website Taman Wisata Matahari Waterpark. Waterpark adalah sarana wahana bermain air dan bagian dari Taman Wisata Matahari. Berlokasi di wilayah pegunungan yang berudara sejuk, semakin menciptakan betah berlama-lama dan juga menjadi loka
tamanwisatamatahariwaterpark.com has a global rank of #4,805,461 which puts itself among the top 10 million most popular websites worldwide. tamanwisatamatahariwaterpark.com rank has decreased -23% over the last 3 months. tamanwisatamatahariwaterpark.com was launched at March 31, 2010 and is 15 years and 76 days. It reaches roughly 2,970 users and delivers about 6,540 pageviews each month. Its estimated monthly revenue is $18.90. We estimate the value of tamanwisatamatahariwaterpark.com to be around $229.95. The domain tamanwisatamatahariwaterpark.com uses a Commercial suffix and its server(s) are located in Indonesia with the IP number 116.90.163.134. tamanwisatamatahariwaterpark.com is also listed on Dmoz.
Webmaster and SEO Tools
SEO Tools > Keyword Density Check
CloseWorth & Traffic Estimate of tamanwisatamatahariwaterpark.com
Estimated numbers for tamanwisatamatahariwaterpark.com - Niche: General - Average CPM: $2.80
For publishers it means average earnings for each 1k impressions.
Example: A website with a $3 CPM and 10000 impressions/pageviews a day is making on average $30 dollars a day.
Daily
Monthly
Yearly
Website Worth: $229.95
Daily Pageviews: 218
Daily Visitors: 99
Daily Ads Revenue: $0.63
Daily Pageviews: 218
Daily Visitors: 99
Daily Ads Revenue: $0.63
Website Worth: $229.95
Monthly Pageviews: 6,540
Monthly Visitors: 2,970
Monthly Ads Revenue: $18.90
Monthly Pageviews: 6,540
Monthly Visitors: 2,970
Monthly Ads Revenue: $18.90
Website Worth: $229.95
Yearly Pageviews: 79,570
Yearly Visitors: 36,135
Yearly Ads Revenue: $229.95
Yearly Pageviews: 79,570
Yearly Visitors: 36,135
Yearly Ads Revenue: $229.95
Choose a specific category/niche
The value and earnings of a website just like a physical company also depends on the market it's focusing.
A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.
Automobile
Average High priced niches
Average Low priced niches
B2B
Banking and Finance
Books & Online content
Consumer durables
Dating
Education
Entertainment
Fashion and Clothing
Fitness
Food
Gaming
General
Hotels and Travel
IT hardware
Jobs
Legal
Machinery or equipment
Medical treatment
Medicines
Miracle drugs or vitamins
Music
News Portals
Random blogs or content
Real Estate
Religion
Science
Shopping Portals
Social networks
Sports
Technology
Webmaster & Web Hosting

A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.

$4.30

$8.00

$2.00

$8.00

$12.00

$2.00

$3.00

$3.50

$9.00

$1.00

$1.50

$6.00

$4.00

$1.50

$2.80

$3.50

$6.00

$2.50

$15.00

$3.00

$8.00

$4.00

$3.50

$1.00

$10.00

$1.00

$7.20

$1.70

$4.50

$2.50

$0.70

$2.00

$8.50

$12.00
Main Information of tamanwisatamatahariwaterpark.com
Information of tamanwisatamatahariwaterpark.com
- Alexa Rank:4,805,461 (
-23% over the last 3 months)
The Alexa rank is a measure of tamanwisatamatahariwaterpark.com's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from tamanwisatamatahariwaterpark.com over the last 3 months.
Google.com ranks #1 for example. - Quantcast Rank:Not ranked/Not available
The Quantcast rank is a measure of tamanwisatamatahariwaterpark.com's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from tamanwisatamatahariwaterpark.com over the last 3 months.
Google.com ranks #1 for example. - Google Pagerank:Not ranked/Not available
Google PageRank reflects the importance of web pages by considering more than 500 million variables and 2 billion terms. Pages that Google search engine believes are important receive a higher PageRank and are more likely to appear at the top of the search results.
PageRank also considers the importance of each page that casts a vote, as votes from some pages are considered to have greater value, thereby giving the linked page a greater value. - IP Address:116.90.163.134
IP Addresses are similar to physical addresses. It's a number that represents the identification and location of a website. Every computer has an IP address. - IP Tracing
- Site Age:15 years and 76 days
- Created:2010-03-31
- Expires:2015-03-31
- Updated:2014-04-01
- Owner:Erick Sarifudin
- ICANN Registrar:PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM
This shows the company who handled the registration of this domain.
- Hosted in:Indonesia
- Domain Suffix:Commercial
A domain suffix is the last part of a domain name and is often referred to as a "top-level domain" or TLD.
.COM is the most popular and it represents Commercial websites.
DNS Records of tamanwisatamatahariwaterpark.com
Host | Type | TTL | Extra |
---|---|---|---|
tamanwisatamatahariwaterpark.com | A | 14400 | IP: 202.43.169.234 |
tamanwisatamatahariwaterpark.com | NS | 86400 | Target: id2.pasarhosting.com |
tamanwisatamatahariwaterpark.com | NS | 86400 | Target: id1.pasarhosting.com |
tamanwisatamatahariwaterpark.com | SOA | 86400 | MNAME: id1.pasarhosting.com RNAME: 2013.logs.liveserver.info Serial: 2018010702 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
tamanwisatamatahariwaterpark.com | MX | 14400 | Target: tamanwisatamatahariwaterpark.com |
Name Servers of tamanwisatamatahariwaterpark.com
id1.pasarhosting.com
id2.pasarhosting.com
Header Info of tamanwisatamatahariwaterpark.com
tamanwisatamatahariwaterpark.com is using nginx admin as server.
Header | HTTP1.1 301 Moved Permanently |
Server | nginx admin |
Date | Fri, 21 Dec 2018 123402 GMT |
Content-Type | texthtml; charset=iso-8859-1 |
Content-Length | 249 |
Connection | keep-alive |
Location | tamanwisatamatahariwaterpark.com |
X-Cache | HIT from Backend |
Search Engine & Internet Presense of tamanwisatamatahariwaterpark.com
A website with a large amount of indexed pages in search engines is more likely to have tons of visits.If you are buying tamanwisatamatahariwaterpark.com or it is your competitor checking how many pages indexed it has is vital.
If tamanwisatamatahariwaterpark.com has no pages indexed it means it's too new, is banned or suffered a penalty.
Internet Presense of tamanwisatamatahariwaterpark.com
- Backlinks:13
This represents how many websites have links redirecting to tamanwisatamatahariwaterpark.com. Backlinks are very important for search engines since more backlinks mean more popularity leading to a better positioning on search engines.
- Google Indexed Pages:View
This represents how many pages from tamanwisatamatahariwaterpark.com are currently visible to the public on Google search engine.
- Yahoo Indexed Pages:View
This represents how many pages from tamanwisatamatahariwaterpark.com are currently visible to the public on Yahoo search engine.
- Bing Indexed Pages:View
This represents how many pages from tamanwisatamatahariwaterpark.com are currently visible to the public on Bing search engine.
- Dmoz Listing:Yes
- Dmoz Title:Taman Wisata Matahari WaterPark
- Dmoz Description:TAMAN WISATA MATAHARI WATERPARK YANG BERADA DI DAERAH CISARUA BOGOR MERUPAKAN TEMPAT REKREASI DAN HIBURAN DENGAN FASILITAS DAN WAHANA AIR YANG SANGAT LENGKAP SEHINGGA SANGAT COCOK UNTUK LIBURAN KELUARGA MAUPUN RELASI KERJA.
- Web Archive:tamanwisatamatahariwaterpark.com (in the past).
Statistical Graphics of tamanwisatamatahariwaterpark.com
Select an option below to analyse several graphic statistics.
Compare this website to:
Period:
IP Tracing of tamanwisatamatahariwaterpark.com
- tamanwisatamatahariwaterpark.com is hosted by PT DWI Tunggal Putra in Jakarta, Jakarta Raya.
- Country:Indonesia
- City:Jakarta
- Region:Jakarta Raya
- Latitude:-6.1744
- Longitude:106.8294
- ASNum:AS18059 DTPNET NAP
- ISP:PT DWI Tunggal Putra
- Organization:PT DWI Tunggal Putra
Similar Domain Names of tamanwisatamatahariwaterpark.com
ramanwisatamatahariwaterpark.com, famanwisatamatahariwaterpark.com, gamanwisatamatahariwaterpark.com, hamanwisatamatahariwaterpark.com, yamanwisatamatahariwaterpark.com, tqmanwisatamatahariwaterpark.com, twmanwisatamatahariwaterpark.com, tzmanwisatamatahariwaterpark.com, txmanwisatamatahariwaterpark.com, tananwisatamatahariwaterpark.com, tahanwisatamatahariwaterpark.com, tajanwisatamatahariwaterpark.com, takanwisatamatahariwaterpark.com, talanwisatamatahariwaterpark.com, tamqnwisatamatahariwaterpark.com, tamwnwisatamatahariwaterpark.com, tamznwisatamatahariwaterpark.com, tamxnwisatamatahariwaterpark.com, tamabwisatamatahariwaterpark.com, tamagwisatamatahariwaterpark.com, tamahwisatamatahariwaterpark.com, tamajwisatamatahariwaterpark.com, tamamwisatamatahariwaterpark.com, tamanqisatamatahariwaterpark.com, tamanaisatamatahariwaterpark.com, tamansisatamatahariwaterpark.com, tamandisatamatahariwaterpark.com, tamaneisatamatahariwaterpark.com, tamanwusatamatahariwaterpark.com, tamanwjsatamatahariwaterpark.com, tamanwksatamatahariwaterpark.com, tamanwlsatamatahariwaterpark.com, tamanwosatamatahariwaterpark.com, tamanwiqatamatahariwaterpark.com, tamanwiwatamatahariwaterpark.com, tamanwieatamatahariwaterpark.com, tamanwizatamatahariwaterpark.com, tamanwixatamatahariwaterpark.com, tamanwicatamatahariwaterpark.com, tamanwisqtamatahariwaterpark.com, tamanwiswtamatahariwaterpark.com, tamanwisztamatahariwaterpark.com, tamanwisxtamatahariwaterpark.com, tamanwisaramatahariwaterpark.com, tamanwisafamatahariwaterpark.com, tamanwisagamatahariwaterpark.com, tamanwisahamatahariwaterpark.com, tamanwisayamatahariwaterpark.com, tamanwisatqmatahariwaterpark.com, tamanwisatwmatahariwaterpark.com, tamanwisatzmatahariwaterpark.com, tamanwisatxmatahariwaterpark.com, tamanwisatanatahariwaterpark.com, tamanwisatahatahariwaterpark.com, tamanwisatajatahariwaterpark.com, tamanwisatakatahariwaterpark.com, tamanwisatalatahariwaterpark.com, tamanwisatamqtahariwaterpark.com, tamanwisatamwtahariwaterpark.com, tamanwisatamztahariwaterpark.com, tamanwisatamxtahariwaterpark.com, tamanwisatamarahariwaterpark.com, tamanwisatamafahariwaterpark.com, tamanwisatamagahariwaterpark.com, tamanwisatamahahariwaterpark.com, tamanwisatamayahariwaterpark.com, tamanwisatamatqhariwaterpark.com, tamanwisatamatwhariwaterpark.com, tamanwisatamatzhariwaterpark.com, tamanwisatamatxhariwaterpark.com, tamanwisatamatabariwaterpark.com, tamanwisatamatagariwaterpark.com, tamanwisatamatatariwaterpark.com, tamanwisatamatayariwaterpark.com, tamanwisatamatauariwaterpark.com, tamanwisatamatajariwaterpark.com, tamanwisatamatamariwaterpark.com, tamanwisatamatanariwaterpark.com, tamanwisatamatahqriwaterpark.com, tamanwisatamatahwriwaterpark.com, tamanwisatamatahzriwaterpark.com, tamanwisatamatahxriwaterpark.com, tamanwisatamatahaeiwaterpark.com, tamanwisatamatahadiwaterpark.com, tamanwisatamatahafiwaterpark.com, tamanwisatamatahagiwaterpark.com, tamanwisatamatahatiwaterpark.com, tamanwisatamataharuwaterpark.com, tamanwisatamataharjwaterpark.com, tamanwisatamataharkwaterpark.com, tamanwisatamataharlwaterpark.com, tamanwisatamataharowaterpark.com, tamanwisatamatahariqaterpark.com, tamanwisatamatahariaaterpark.com, tamanwisatamataharisaterpark.com, tamanwisatamataharidaterpark.com, tamanwisatamataharieaterpark.com, tamanwisatamatahariwqterpark.com, tamanwisatamatahariwwterpark.com, tamanwisatamatahariwzterpark.com, tamanwisatamatahariwxterpark.com, tamanwisatamatahariwarerpark.com, tamanwisatamatahariwaferpark.com, tamanwisatamatahariwagerpark.com, tamanwisatamatahariwaherpark.com, tamanwisatamatahariwayerpark.com, tamanwisatamatahariwatwrpark.com, tamanwisatamatahariwatsrpark.com, tamanwisatamatahariwatdrpark.com, tamanwisatamatahariwatfrpark.com, tamanwisatamatahariwatrrpark.com, tamanwisatamatahariwateepark.com, tamanwisatamatahariwatedpark.com, tamanwisatamatahariwatefpark.com, tamanwisatamatahariwategpark.com, tamanwisatamatahariwatetpark.com, tamanwisatamatahariwateroark.com, tamanwisatamatahariwaterlark.com, tamanwisatamatahariwaterpqrk.com, tamanwisatamatahariwaterpwrk.com, tamanwisatamatahariwaterpzrk.com, tamanwisatamatahariwaterpxrk.com, tamanwisatamatahariwaterpaek.com, tamanwisatamatahariwaterpadk.com, tamanwisatamatahariwaterpafk.com, tamanwisatamatahariwaterpagk.com, tamanwisatamatahariwaterpatk.com, tamanwisatamatahariwaterparu.com, tamanwisatamatahariwaterparj.com, tamanwisatamatahariwaterparm.com, tamanwisatamatahariwaterparl.com, tamanwisatamatahariwaterparo.com,Whois Record of tamanwisatamatahariwaterpark.com
Domain Name: TAMANWISATAMATAHARIWATERPARK.COM
Registry Domain ID: 1590945934_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 01-Apr-2014
Creation Date: 31-Mar-2010
Registrar Registration Expiration Date: 31-Mar-2015
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: [Spam Protected Email]
Registrar Abuse Contact Phone: +1-2013775952
Domain Status: clientTransferProhibited
Registry Registrant ID: DI_10192840
Registrant Name: Erick Sarifudin
Registrant Organization: A Team
Registrant Street: Jl. raya wanguh atas no. 08 E Kec. Bogor Utara
Registrant City: Bogor
Registrant State/Province: Jawa Barat
Registrant Postal Code: 16720
Registrant Country: ID
Registrant Phone: +62.2519297565
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: [Spam Protected Email]
Registry Admin ID: DI_10192840
Admin Name: Erick Sarifudin
Admin Organization: A Team
Admin Street: Jl. raya wanguh atas no. 08 E Kec. Bogor Utara
Admin City: Bogor
Admin State/Province: Jawa Barat
Admin Postal Code: 16720
Admin Country: ID
Admin Phone: +62.2519297565
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: [Spam Protected Email]
Registry Tech ID: DI_10192840
Tech Name: Erick Sarifudin
Tech Organization: A Team
Tech Street: Jl. raya wanguh atas no. 08 E Kec. Bogor Utara
Tech City: Bogor
Tech State/Province: Jawa Barat
Tech Postal Code: 16720
Tech Country: ID
Tech Phone: +62.2519297565
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: [Spam Protected Email]
Name Server: id1.pasarhosting.com
Name Server: id2.pasarhosting.com
DNSSEC:Unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/
>>>Last update of WHOIS database: 2014-08-20T23:17:54+0000Z<<<
Registration Service Provided By: PASARHOSTING.COM
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.
Registry Domain ID: 1590945934_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 01-Apr-2014
Creation Date: 31-Mar-2010
Registrar Registration Expiration Date: 31-Mar-2015
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: [Spam Protected Email]
Registrar Abuse Contact Phone: +1-2013775952
Domain Status: clientTransferProhibited
Registry Registrant ID: DI_10192840
Registrant Name: Erick Sarifudin
Registrant Organization: A Team
Registrant Street: Jl. raya wanguh atas no. 08 E Kec. Bogor Utara
Registrant City: Bogor
Registrant State/Province: Jawa Barat
Registrant Postal Code: 16720
Registrant Country: ID
Registrant Phone: +62.2519297565
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: [Spam Protected Email]
Registry Admin ID: DI_10192840
Admin Name: Erick Sarifudin
Admin Organization: A Team
Admin Street: Jl. raya wanguh atas no. 08 E Kec. Bogor Utara
Admin City: Bogor
Admin State/Province: Jawa Barat
Admin Postal Code: 16720
Admin Country: ID
Admin Phone: +62.2519297565
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: [Spam Protected Email]
Registry Tech ID: DI_10192840
Tech Name: Erick Sarifudin
Tech Organization: A Team
Tech Street: Jl. raya wanguh atas no. 08 E Kec. Bogor Utara
Tech City: Bogor
Tech State/Province: Jawa Barat
Tech Postal Code: 16720
Tech Country: ID
Tech Phone: +62.2519297565
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: [Spam Protected Email]
Name Server: id1.pasarhosting.com
Name Server: id2.pasarhosting.com
DNSSEC:Unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/
>>>Last update of WHOIS database: 2014-08-20T23:17:54+0000Z<<<
Registration Service Provided By: PASARHOSTING.COM
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.